PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30192-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 340aa    MW: 35988.9 Da    PI: 4.61
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30192-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.98e-373691661
           zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                      +cprCds ntkfCyynnyslsqPryfCk+Crr+WtkGG+lrnvPvGgg+rkn++ 
  TRIUR3_30192-P1 36 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRHWTKGGSLRNVPVGGGCRKNRRG 91
                     68***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-302190IPR003851Zinc finger, Dof-type
PfamPF027012.1E-313690IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.363690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MLSSHCESML AYAAAAGRRA MLVDPRRYRP NVEVAPNCPR CDSPNTKFCY YNNYSLSQPR  60
YFCKGCRRHW TKGGSLRNVP VGGGCRKNRR GKSSVRSASD SFSGVRDATF GHGGFPGPLR  120
PDMVLEGMVG NPANPGQVMH DVPTAPDGSS IDLAMLYSKF LNNQQPAGDG SLQPAGAGSL  180
GGSVTPESAG GHVDETFDTF SASSDMSPAG VLAPAQFDAS PDGFLEWSRP VSSADPTCTA  240
SPATATTMLC TDESVQAALG ELNFAMDQSC FDSLGLPTDG AAANLSSWCS IVPSLSTWEE  300
PKYDSLDSFP DDTLSLHDGI LAADHDWSAD CQGLEALYMP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970693.11e-158PREDICTED: uncharacterized protein LOC101752604
TrEMBLM7ZKY50.0M7ZKY5_TRIUA; Dof zinc finger protein DOF3.5
STRINGMLOC_61071.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.17e-37Dof family protein